PDB entry 2i5f
View 2i5f on RCSB PDB site
Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,5,6)P5
Class: lipid binding protein
Keywords: PH domain, protein-inositol phosphate complex, LIPID BINDING PROTEIN
Deposited on
2006-08-24, released
2007-08-07
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.179
AEROSPACI score: 0.71
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pleckstrin
Species: Homo sapiens [TaxId:9606]
Gene: PLEK, P47
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2i5fa_ - Heterogens: 5IP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2i5fA (A:)
gsftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvt
svesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
Sequence, based on observed residues (ATOM records): (download)
>2i5fA (A:)
ftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsv
eseenlfeiitadevhyflqaatpkertewikaiqmasr