PDB entry 2i5d

View 2i5d on RCSB PDB site
Description: Crystal Structure of Human Inosine Triphosphate Pyrophosphatase
Class: hydrolase
Keywords: Monomeric protein, HYDROLASE
Deposited on 2006-08-24, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine triphosphate pyrophosphohydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ITPA, C20orf37
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BY32 (2-196)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2i5da2, d2i5da3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i5dA (A:)
    gshmaaslvgkkivfvtgnakkleevvqilgdkfpctlvaqkidlpeyqgepdeisiqkc
    qeavrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalct
    falstgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavsh
    rfrallelqeyfgslaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i5dA (A:)
    hmaaslvgkkivfvtgnakkleevvqilgdkfpctlvaqkidlpeyqgepdeisiqkcqe
    avrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalctfa
    lstgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavshrf
    rallelqeyfgslaa