PDB entry 2i5c

View 2i5c on RCSB PDB site
Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,4,5)P5
Class: lipid binding protein
Keywords: PH domain, protein-inositol phosphate complex, LIPID BINDING PROTEIN
Deposited on 2006-08-24, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i5ca_
  • Chain 'B':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i5cb_
  • Chain 'C':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i5cc_
  • Heterogens: IP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i5cA (A:)
    gsftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvt
    svesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i5cA (A:)
    viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
    lfeiitadevhyflqaatpkertewikaiqmasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i5cB (B:)
    gsftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvt
    svesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i5cB (B:)
    viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
    lfeiitadevhyflqaatpkertewikaiqmasr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i5cC (C:)
    gsftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvt
    svesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i5cC (C:)
    viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
    lfeiitadevhyflqaatpkertewikaiqmasr