PDB entry 2i53

View 2i53 on RCSB PDB site
Description: Crystal structure of Cyclin K
Class: cell cycle
Keywords: cell cycle, transcription, cyclin k, cyclin box, cdk9, positive transcription elongation factor, p-tefb
Deposited on 2006-08-23, released 2007-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin K
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i53a1, d2i53a2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i53A (A:)
    gsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhyd
    tlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqf
    gqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfv
    ndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvled
    ichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i53A (A:)
    sanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlat
    giiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfg
    ddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndsl
    cttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichq
    ildlysqgkqqmph