PDB entry 2i4x

View 2i4x on RCSB PDB site
Description: HIV-1 Protease I84V, L90M with GS-8374
Class: hydrolase
Keywords: HIV-1 protease I84VL90M inhibitor, hydrolase
Deposited on 2006-08-22, released 2007-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.243
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368
      • engineered (83)
      • engineered (89)
      • conflict (94)
    Domains in SCOPe 2.04: d2i4xa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (83)
      • engineered (89)
      • conflict (94)
    Domains in SCOPe 2.04: d2i4xb_
  • Heterogens: KGQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i4xA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i4xB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf