PDB entry 2i4x
View 2i4x on RCSB PDB site
Description: HIV-1 Protease I84V, L90M with GS-8374
Class: hydrolase
Keywords: HIV-1 protease I84VL90M inhibitor, hydrolase
Deposited on
2006-08-22, released
2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.243
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P03368
- engineered (83)
- engineered (89)
- conflict (94)
Domains in SCOPe 2.08: d2i4xa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P03368 (0-98)
- engineered (83)
- engineered (89)
- conflict (94)
Domains in SCOPe 2.08: d2i4xb_ - Heterogens: KGQ, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4xA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4xB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf