PDB entry 2i4v
View 2i4v on RCSB PDB site
Description: HIV-1 protease I84V, L90M with TMC126
Class: hydrolase
Keywords: HIV-1 protein inhibitor mutant, hydrolase
Deposited on
2006-08-22, released
2007-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.219
AEROSPACI score: 0.6
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P03368
- engineered (83)
- engineered (89)
- conflict (94)
Domains in SCOPe 2.05: d2i4va_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P03368 (0-98)
- engineered (83)
- engineered (89)
- conflict (94)
Domains in SCOPe 2.05: d2i4vb_ - Heterogens: DJR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4vA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4vB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf