PDB entry 2i4v

View 2i4v on RCSB PDB site
Description: HIV-1 protease I84V, L90M with TMC126
Class: hydrolase
Keywords: HIV-1 protein inhibitor mutant, hydrolase
Deposited on 2006-08-22, released 2007-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.219
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368
    • engineered (83)
    • engineered (89)
    • conflict (94)
  Domains in SCOPe 2.05: d2i4va_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (0-98)
    • engineered (83)
    • engineered (89)
    • conflict (94)
  Domains in SCOPe 2.05: d2i4vb_
• Heterogens: DJR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i4vA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i4vB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvnvigrnlmtqigmtlnf