PDB entry 2i4d

View 2i4d on RCSB PDB site
Description: Crystal structure of WT HIV-1 protease with GS-8373
Class: hydrolase
Keywords: HIV-1 Protease, hydrolase
Deposited on 2006-08-21, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.241
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368
      • conflict (94)
    Domains in SCOPe 2.07: d2i4da_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • conflict (94)
    Domains in SCOPe 2.07: d2i4db_
  • Heterogens: QFI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i4dA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i4dB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnf