PDB entry 2i4d
View 2i4d on RCSB PDB site
Description: Crystal structure of WT HIV-1 protease with GS-8373
Class: hydrolase
Keywords: HIV-1 Protease, hydrolase
Deposited on
2006-08-21, released
2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.241
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2i4da_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2i4db_ - Heterogens: QFI, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4dA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2i4dB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf