PDB entry 2i3w

View 2i3w on RCSB PDB site
Description: Measurement of conformational changes accompanying desensitization in an ionotropic glutamate receptor: Structure of S729C mutant
Class: membrane protein
Keywords: Ionotropic glutamate receptor ligand binding core S1S2 G729C mutant, MEMBRANE PROTEIN
Deposited on 2006-08-21, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate receptor subunit 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (117-258)
      • linker (115-116)
    Domains in SCOPe 2.07: d2i3wa_
  • Chain 'B':
    Compound: glutamate receptor subunit 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (117-258)
      • linker (115-116)
    Domains in SCOPe 2.07: d2i3wb_
  • Heterogens: GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i3wA (A:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlkln
    eqglldklknkwwydkgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3wA (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i3wB (B:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlkln
    eqglldklknkwwydkgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3wB (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec