PDB entry 2i3t

View 2i3t on RCSB PDB site
Description: Bub3 complex with Mad3 (BubR1) GLEBS motif
Class: cell cycle
Keywords: WD40 protein, beta propeller, mitotic spindle checkpoint, CELL CYCLE
Deposited on 2006-08-20, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3ta_
  • Chain 'B':
    Compound: Spindle assembly checkpoint component
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAD3, YJL013C, J1341
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47074 (1-End)
      • initiating methionine (0)
  • Chain 'C':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3tc_
  • Chain 'D':
    Compound: Spindle assembly checkpoint component
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAD3, YJL013C, J1341
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47074 (1-End)
      • initiating methionine (0)
  • Chain 'E':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3te_
  • Chain 'F':
    Compound: Spindle assembly checkpoint component
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAD3, YJL013C, J1341
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47074 (1-End)
      • initiating methionine (0)
  • Chain 'G':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3tg_
  • Chain 'H':
    Compound: Spindle assembly checkpoint component
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAD3, YJL013C, J1341
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47074 (1-End)
      • initiating methionine (0)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i3tA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3tA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i3tC (C:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3tC (C:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2i3tE (E:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3tE (E:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2i3tG (G:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3tG (G:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'H':
    No sequence available.