PDB entry 2i3s

View 2i3s on RCSB PDB site
Description: Bub3 complex with Bub1 GLEBS motif
Class: cell cycle
Keywords: WD40 protein, beta-propeller, GLEBS motif, mitotic spindle checkpoint, CELL CYCLE
Deposited on 2006-08-20, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3sa_
  • Chain 'B':
    Compound: Checkpoint serine/threonine-protein kinase
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3sc_
  • Chain 'D':
    Compound: Checkpoint serine/threonine-protein kinase
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cell cycle arrest protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3, YOR026W, OR26.16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i3se_
  • Chain 'F':
    Compound: Checkpoint serine/threonine-protein kinase
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i3sA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyenelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3sA (A:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnkiftmdtnssrlivgmnnsqvqwfrlplceddngt
    ieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrchrlnlk
    dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
    lclatsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i3sC (C:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyenelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3sC (C:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsknkiftmdtnssrlivgmnnsqvqwfrlplceddng
    tieesglkyqirdvallpkeqegyacssidgrvaveffddskrfafrchrlnlkdtnlay
    pvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilclats
    ddtfktnaaidqtielnassiyiifdye
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2i3sE (E:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
    hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
    acsdnilclatsddtfktnaaidqtielnassiyiifdyenelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i3sE (E:)
    mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
    ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
    dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
    eddngtieesglkyqirdvallpkeqegyacssidgrvaveffdskrfafrchrlnlkdt
    nlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilc
    latsddtfktnaaidqtielnassiyiifdye
    

  • Chain 'F':
    No sequence available.