PDB entry 2i3h

View 2i3h on RCSB PDB site
Description: Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
Class: inhibitor/apoptosis
Keywords: zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design
Deposited on 2006-08-18, released 2006-09-19
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-19, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.162
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: HOMO SAPIENS
    Gene: BIRC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CA5
      • see remark 999 (110)
      • see remark 999 (120-127)
    Domains in SCOP 1.75: d2i3ha1
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: HOMO SAPIENS
    Gene: BIRC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CA5 (Start-132)
      • see remark 999 (110)
      • see remark 999 (120-128)
      • see remark 999 (132)
    Domains in SCOP 1.75: d2i3hb1
  • Chain 'C':
    Compound: AVPW peptide
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: AVPW peptide
    Species: synthetic, synthetic
  • Heterogens: ZN, LI, BTB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2i3hA (A:)
mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpgcqfllrskg
qeyinnihlthsl

    Sequence, based on observed residues (ATOM records): (download) 
    >2i3hA (A:)
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2i3hB (B:)
mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpgcqfllrskg
qeyinnihlthsl

    Sequence, based on observed residues (ATOM records): (download) 
    >2i3hB (B:)
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlthsl

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.