PDB entry 2i3e

View 2i3e on RCSB PDB site
Description: Solution structure of catalytic domain of goldfish RICH protein
Class: hydrolase
Keywords: RICH protein, CNP, 2',3'-cyclic-nucleotide 3'-phosphodiesterase, nerve regeneration, HYDROLASE
Deposited on 2006-08-18, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g-rich
    Species: Carassius auratus [TaxId:7957]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90306 (4-221)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d2i3ea1, d2i3ea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i3eA (A:)
    gshmelplffgwfllpeeeerikcatmdflktldtleafkehiseftgeaekevdleqyf
    qnplqlhcttkfcdygkaegakeyaelqvvkesltksyelsvtalivtprtfgarvalte
    aqvklwpegadkegvapallpsvealpagsrahvtlgcsagvetvqtgldlleilalqke
    gkegtqvemdlgtltylsegrwflalrepinadttftsfsed