PDB entry 2i32

View 2i32 on RCSB PDB site
Description: Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly
Class: replication chaperone
Keywords: Histone Deposition, Chromatin Regulation, Histone Chaperones, ASF1, HIRA, CAF-1, REPLICATION CHAPERONE
Deposited on 2006-08-17, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-Silencing Factor 1 paralog a
    Species: Homo sapiens [TaxId:9606]
    Gene: ASF1A, DKFZp564E2182
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i32a1
  • Chain 'B':
    Compound: Anti-Silencing Factor 1 paralog a
    Species: Homo sapiens [TaxId:9606]
    Gene: ASF1A, DKFZp564E2182
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i32b_
  • Chain 'E':
    Compound: Histone Regulatory homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIRA, DGCR1, HIR, TUPLE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Histone Regulatory homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIRA, DGCR1, HIR, TUPLE1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i32A (A:)
    mgsshhhhhhdydipttenlyfqgsmakvqvnnvvvldnpspfynpfqfeitfeciedls
    edlewkiiyvgsaeseeydqvldsvlvgpvpagrhmfvfqadapnpglipdadavgvtvv
    litctyrgqefirvgyyvnneytetelrenppvkpdfsklqrnilasnprvtrfhinwed
    nt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i32A (A:)
    makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
    lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
    elrenppvkpdfsklqrnilasnprvtrfhinwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i32B (B:)
    mgsshhhhhhdydipttenlyfqgsmakvqvnnvvvldnpspfynpfqfeitfeciedls
    edlewkiiyvgsaeseeydqvldsvlvgpvpagrhmfvfqadapnpglipdadavgvtvv
    litctyrgqefirvgyyvnneytetelrenppvkpdfsklqrnilasnprvtrfhinwed
    nt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i32B (B:)
    makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
    lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
    elrenppvkpdfsklqrnilasnprvtrfhinwe
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.