PDB entry 2i2w

View 2i2w on RCSB PDB site
Description: Crystal Structure of Escherichia Coli Phosphoheptose Isomerase
Class: isomerase
Keywords: lipopolysaccharide biosynthesis, phosphoheptose isomerase, isomerase
Deposited on 2006-08-17, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.172
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoheptose isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: gmhA, lpcA, tfrA, b0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i2wa_
  • Chain 'B':
    Compound: Phosphoheptose isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: gmhA, lpcA, tfrA, b0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i2wb_
  • Chain 'C':
    Compound: Phosphoheptose isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: gmhA, lpcA, tfrA, b0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i2wc_
  • Chain 'D':
    Compound: Phosphoheptose isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: gmhA, lpcA, tfrA, b0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i2wd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i2wA (A:)
    mgsshhhhhhssglvprgshmyqdlirnelneaaetlanflkddanihaiqraavllads
    fkaggkvlscgnggshcdamhfaeeltgryrenrpgypaiaisdvshiscvgndfgfndi
    fsryveavgregdvllgistsgnsanvikaiaaarekgmkvitltgkdggkmagtadiei
    rvphfgyadriqeihikvihiliqliekemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i2wA (A:)
    myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
    hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
    sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
    iliqliekemvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i2wB (B:)
    mgsshhhhhhssglvprgshmyqdlirnelneaaetlanflkddanihaiqraavllads
    fkaggkvlscgnggshcdamhfaeeltgryrenrpgypaiaisdvshiscvgndfgfndi
    fsryveavgregdvllgistsgnsanvikaiaaarekgmkvitltgkdggkmagtadiei
    rvphfgyadriqeihikvihiliqliekemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i2wB (B:)
    myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
    hfaeeltgryrenrpgypaiaindifsryveavgregdvllgistsgnsanvikaiaaar
    ekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvihiliqliekemvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i2wC (C:)
    mgsshhhhhhssglvprgshmyqdlirnelneaaetlanflkddanihaiqraavllads
    fkaggkvlscgnggshcdamhfaeeltgryrenrpgypaiaisdvshiscvgndfgfndi
    fsryveavgregdvllgistsgnsanvikaiaaarekgmkvitltgkdggkmagtadiei
    rvphfgyadriqeihikvihiliqliekemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i2wC (C:)
    myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
    hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
    sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
    iliqliekemvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i2wD (D:)
    mgsshhhhhhssglvprgshmyqdlirnelneaaetlanflkddanihaiqraavllads
    fkaggkvlscgnggshcdamhfaeeltgryrenrpgypaiaisdvshiscvgndfgfndi
    fsryveavgregdvllgistsgnsanvikaiaaarekgmkvitltgkdggkmagtadiei
    rvphfgyadriqeihikvihiliqliekemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i2wD (D:)
    myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
    hfaeeltgryrenrpgypaiaisndifsryveavgregdvllgistsgnsanvikaiaaa
    rekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvihiliqliekemvk