PDB entry 2i27

View 2i27 on RCSB PDB site
Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor Ancestral variable domain
Class: Immune system
Keywords: immunoglobulin fold, Immune system
Deposited on 2006-08-15, released 2007-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.22
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: New Antigen Receptor Ancestral
    Species: Ginglymostoma cirratum [TaxId:7801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i27n_
  • Chain 'O':
    Compound: New Antigen Receptor Ancestral
    Species: Ginglymostoma cirratum [TaxId:7801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i27o_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2i27N (N:)
    arvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvn
    sgsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvnaaahhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i27N (N:)
    rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
    gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvnaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2i27O (O:)
    arvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvn
    sgsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvnaaahhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i27O (O:)
    rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
    gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvna