PDB entry 2i1q

View 2i1q on RCSB PDB site
Description: RadA Recombinase in complex with Calcium
Class: recombination
Keywords: ATPASE, RECOMBINASE, ATP COMPLEX, Calcium stimulation, RecA, Rad51, DMC1, RadA, RECOMBINATION
Deposited on 2006-08-14, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i1qa1, d2i1qa2
  • Heterogens: MG, CA, NA, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i1qA (A:)
    mgdnltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlc
    dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
    nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
    raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
    lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
    ydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i1qA (A:)
    ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
    ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
    peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
    sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
    adlfncvvlvtnqvsakaeqaigghivghaatfrffvrkgkgdkrvaklydsphlpdaea
    ifritekgiqd