PDB entry 2i1m

View 2i1m on RCSB PDB site
Description: cFMS tyrosine kinase (tie2 KID) in complex with an arylamide inhibitor
Class: transferase
Keywords: Kinase Domain, Kinase Inhibitor Complex, transferase
Deposited on 2006-08-14, released 2006-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.25
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333 (Start-143)
      • see remark 999 (144-150)
      • see remark 999 (158-162)
    • Uniprot P07333 (163-End)
    Domains in SCOPe 2.05: d2i1ma_
  • Heterogens: 5CN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i1mA (A:)
    gvdykykqkpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafg
    kvveatafglgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgact
    hggpvlviteyccygdllnflrrksrvletdpafaianstastrdllhfssqvaqgmafl
    askncihrdvaarnvlltnghvakigdfglardimndsnyivkgnarlpvkwmapesifd
    cvytvqsdvwsygillweifslglnpypgilvnskfyklvkdgyqmaqpafapkniysim
    qacwalepthrptfqqicsflqeqaqedrrerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i1mA (A:)
    qvrwkiiesynsytfidptqlpynekwefprnnlqfgktlgagafgkvveatafglgked
    avlkvavkmlkstahadekealmselkimshlgqhenivnllgacthggpvlviteyccy
    gdllnflrrksrvletdstastrdllhfssqvaqgmaflaskncihrdvaarnvlltngh
    vakigdfglardimndsnyivkgnarlpvkwmapesifdcvytvqsdvwsygillweifs
    lglnpypgilvnskfyklvkdgyqmaqpafapkniysimqacwalepthrptfqqicsfl
    qeqaqedrrer