PDB entry 2i1l

View 2i1l on RCSB PDB site
Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
Class: transferase
Keywords: FAD synthetase, Crystal structure, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, TRANSFERASE
Deposited on 2006-08-14, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0857
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZW1
      • modified residue (21)
      • modified residue (53)
      • modified residue (61)
      • modified residue (213)
      • modified residue (253)
      • modified residue (279)
    Domains in SCOPe 2.07: d2i1la1, d2i1la2
  • Chain 'B':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0857
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZW1
      • modified residue (21)
      • modified residue (53)
      • modified residue (61)
      • modified residue (213)
      • modified residue (253)
      • modified residue (279)
    Domains in SCOPe 2.07: d2i1lb1, d2i1lb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i1lA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i1lA (A:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivfptanidrgneklvd
    lkrgvylvrvhlpdgkkkfgvmnvgfrnvkyevyildfegdlygqrlklevlkfmrdekk
    eelkaaidqdvksarnmiddiinskfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i1lB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i1lB (B:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhptanidrgneklvd
    lkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildfegdlygqrlklevlkfmrdekkf
    dsieelkaaidqdvksarnmiddiinskf