PDB entry 2i15

View 2i15 on RCSB PDB site
Description: Crystal structure of MPN423 from Mycoplasma pneumoniae
Class: structural genomics, unknown function
Keywords: Structural genomics, MPN423, Hypothetical protein, all alpha structure, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, UNKNOWN FUNCTION
Deposited on 2006-08-12, released 2006-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-02, with a file datestamp of 2020-08-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein MG296 homolog
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Gene: MPN423, MP418
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i15a1
  • Chain 'B':
    Compound: Hypothetical protein MG296 homolog
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Gene: MPN423, MP418
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i15b_
  • Chain 'C':
    Compound: Hypothetical protein MG296 homolog
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Gene: MPN423, MP418
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i15c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i15A (A:)
    ggggggmkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsffl
    kpmlsdaffissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgr
    yhqqlgkrfgvltvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i15A (A:)
    mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
    affissevvkqldlpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvlt
    vy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i15B (B:)
    ggggggmkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsffl
    kpmlsdaffissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgr
    yhqqlgkrfgvltvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i15B (B:)
    mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
    affissevvkqldlpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvlt
    vy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i15C (C:)
    ggggggmkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsffl
    kpmlsdaffissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgr
    yhqqlgkrfgvltvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i15C (C:)
    mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
    affissevvkqvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvltvy