PDB entry 2i14

View 2i14 on RCSB PDB site
Description: Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus
Class: transferase
Keywords: nicotinate-nucleotide pyrophosphorylase, crystal structure, ligand binding, phosphoribosylpyrophosphate, zn metal ion, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, TRANSFERASE
Deposited on 2006-08-12, released 2006-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14a1, d2i14a2
  • Chain 'B':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14b1, d2i14b2
  • Chain 'C':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14c1, d2i14c2
  • Chain 'D':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14d1, d2i14d2
  • Chain 'E':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14e1, d2i14e2
  • Chain 'F':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i14f1, d2i14f2
  • Heterogens: ZN, PCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i14A (A:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14A (A:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i14B (B:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14B (B:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i14C (C:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14C (C:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i14D (D:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14D (D:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2i14E (E:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14E (E:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2i14F (F:)
    ggggggmkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwg
    vlvgveevakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasg
    iataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavg
    tmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrl
    dtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaias
    akpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepl
    lkpiiengeivvefpkareireyvleqakkfnlei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i14F (F:)
    mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
    evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataal
    rikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphal
    iitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklfavrldtpssr
    rgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvggaiasakpvdf
    aldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnakvepllkpiie
    ngeivvefpkareireyvleqakkfnlei