PDB entry 2i13

View 2i13 on RCSB PDB site
Description: Aart, a six finger zinc finger designed to recognize ANN triplets
Class: DNA binding protein/DNA
Keywords: DNA binding, zinc finger
Deposited on 2006-08-12, released 2006-10-03
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aart
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2i13a1
  • Chain 'B':
    Compound: Aart
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2i13b1
  • Chain 'C':
    Compound: 5'-d(*cp*ap*gp*ap*tp*gp*tp*ap*gp*gp*gp*ap*ap*ap*ap*gp*cp*cp*cp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*gp*cp*cp*cp*gp*gp*gp*cp*tp*tp*tp*tp*cp*cp*cp*tp*ap*cp*ap*tp*cp*t)-3'
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 5'-d(*cp*ap*gp*ap*tp*gp*tp*ap*gp*gp*gp*ap*ap*ap*ap*gp*cp*cp*cp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*gp*cp*cp*cp*gp*gp*gp*cp*tp*tp*tp*tp*cp*cp*cp*tp*ap*cp*ap*tp*cp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i13A (A:)
    isefgssssvaqaalepgekpyacpecgksfsrsdhlaehqrthtgekpykcpecgksfs
    dkkdltrhqrthtgekpykcpecgksfsqranlrahqrthtgekpyacpecgksfsqlah
    lrahqrthtgekpykcpecgksfsrednlhthqrthtgekpykcpecgksfsrrdalnvh
    qrthtgkkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i13A (A:)
    fsrsdhlaehqrthkpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqranl
    rahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlhthq
    rthtgekpykcpecgksfsrrdalnvhqrth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i13B (B:)
    isefgssssvaqaalepgekpyacpecgksfsrsdhlaehqrthtgekpykcpecgksfs
    dkkdltrhqrthtgekpykcpecgksfsqranlrahqrthtgekpyacpecgksfsqlah
    lrahqrthtgekpykcpecgksfsrednlhthqrthtgekpykcpecgksfsrrdalnvh
    qrthtgkkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i13B (B:)
    kpyacpecgksfsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpyk
    cpecgksfsqranlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpec
    gksfsrednlhthqrthtrrdaln
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.