PDB entry 2i0v

View 2i0v on RCSB PDB site
Description: c-FMS tyrosine kinase in complex with a quinolone inhibitor
Class: transferase
Keywords: Receptor Tyrosine Kinase, Kinase-Inhibitor complex, transferase
Deposited on 2006-08-11, released 2006-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.266
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cFMS Tyrosine Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333 (Start-143)
      • see remark 999 (144)
      • see remark 999 (161-164)
    • Uniprot P07333 (165-End)
    Domains in SCOPe 2.05: d2i0va_
  • Heterogens: SO4, 6C3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i0vA (A:)
    gvdykykqkpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafg
    kvveatafglgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgact
    hggpvlviteyccygdllnflrrkrppgleysynpshnpeeqlssrdllhfssqvaqgma
    flaskncihrdvaarnvlltnghvakigdfglardimndsnyivkgnarlpvkwmapesi
    fdcvytvqsdvwsygillweifslglnpypgilvnskfyklvkdgyqmaqpafapkniys
    imqacwalepthrptfqqicsflqeqaqedrrerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0vA (A:)
    pkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafgkvveatafg
    lgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgacthggpvlvit
    eyccygdllnflrrkrqlssrdllhfssqvaqgmaflaskncihrdvaarnvlltnghva
    kigdfglardimndsnyivkgarlpvkwmapesifdcvytvqsdvwsygillweifslgl
    npypgilvnskfyklvkdgyqmaqpafapkniysimqacwalepthrptfqqicsflqeq
    aqe