PDB entry 2i0q

View 2i0q on RCSB PDB site
Description: Crystal structure of a telomere single-strand DNA-protein complex from O. nova with full-length alpha and beta telomere proteins
Class: structural protein/DNA
Keywords: SINGLE STRAND DNA-PROTEIN COMPLEX, structural protein/DNA COMPLEX
Deposited on 2006-08-11, released 2006-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.243
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-56A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i0qa1, d2i0qa2, d2i0qa3
  • Chain 'B':
    Compound: Telomere-binding protein beta subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-41A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i0qb1
  • Chain 'D':
    Compound: 5'-d(*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i0qA (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0qA (A:)
    kyeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagda
    sdyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkr
    svtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytal
    nkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrir
    satydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavv
    ltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrkt
    kkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkn
    adarkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i0qB (B:)
    mskgasapqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffva
    pyftkeavnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhs
    fkpnlqerlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaag
    kkgkvdagivkasaskgdefsdfsfkegntatlkiadifvqekgkdalnkaadhtdgakv
    kggakgkgkaaakaakgkklsakkgdssaadvrksvdkivkytpskgsrkdtpqksqapa
    agkssakkggkkavpsapspsgkksalttdkmtmaqfvkyldwhekkkggkvssggkvlg
    krsagkasatsgkaskaskktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0qB (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg
    

  • Chain 'D':
    No sequence available.