PDB entry 2i0n

View 2i0n on RCSB PDB site
Description: Structure of Dictyostelium discoideum Myosin VII SH3 domain with adjacent proline rich region
Class: structural protein
Keywords: BETA-SHEET LOOP, structural protein
Deposited on 2006-08-10, released 2007-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class VII unconventional myosin
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: myoI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U1M8 (9-79)
      • cloning artifact (0-8)
    Domains in SCOPe 2.06: d2i0na1, d2i0na2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i0nA (A:)
    mgplgspefakyaralkdynvsdtsllpfkrndiititfkdqenkwfmgqlngkegsfpv
    dhveillsdvpppqpvhpva