PDB entry 2i0k

View 2i0k on RCSB PDB site
Description: Cholesterol Oxidase from Brevibacterium sterolicum- His121Ala Mutant
Class: oxidoreductase
Keywords: oxidoreductase, MIX ALPHA BETA, covalent FAD, Flavoenzyme
Deposited on 2006-08-10, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase
    Species: Brevibacterium sterolicum [TaxId:1702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SID9 (Start-560)
      • engineered (68)
    Domains in SCOPe 2.08: d2i0ka1, d2i0ka2
  • Heterogens: MN, CAC, FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i0kA (A:)
    stgpvaplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdy
    kirprgamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaiv
    telqkhdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltav
    vwngttyaletyqrndpritplltnlgrcfltsvtmqagpnfrqrcqsytdipwrelfap
    kgadgrtfekfvaesggaeaiwypftekpwmkvwtvsptkpdssnevgslgsagslvgkp
    pqarevsgpynyifsdnlpepitdmigainagnpgiaplfgpamyeitklglaatnandi
    wgwskdvqfyikattlrltegggavvtsraniatvindftewfheriefyrakgefplng
    pveirccgldqaadvkvpsvgpptisatrprpdhpdwdvaiwlnvlgvpgtpgmfefyre
    meqwmrshynnddatfrpewskgwafgpdpytdndivtnkmratyiegvpttenwdtara
    rynqidphrvftngfmdkllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0kA (A:)
    aplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirpr
    gamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelqk
    hdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwngt
    tyaletyqrndpritplltnlgrcfltsvtmqagpnfrqrcqsytdipwrelfapkgadg
    rtfekfvaesggaeaiwypftekpwmkvwtvsgkppqarevsgpynyifsdnlpepitdm
    igainagnpgiaplfgpamyeitklglaatnandiwgwskdvqfyikattlrltegggav
    vtsraniatvindftewfheriefyrakgefplngpveirccgldqaadvkvpsvgppti
    satrprpdhpdwdvaiwlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwa
    fgpdpytdndivtnkmratyiegvpttenwdtararynqidphrvftngfmdkllp