PDB entry 2i0e

View 2i0e on RCSB PDB site
Description: Structure of catalytic domain of human protein kinase C beta II complexed with a bisindolylmaleimide inhibitor
Class: transferase
Keywords: Protein Kinase C Beta II, Protein Kinase C, Serine/Threonine Protein Kinase, transferase
Deposited on 2006-08-10, released 2006-11-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Kinase C-beta II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05771
      • modified residue (179)
      • see remark 999 (301-302)
      • see remark 999 (306)
      • see remark 999 (310-311)
      • see remark 999 (315)
      • see remark 999 (317-318)
      • modified residue (320)
      • see remark 999 (322)
      • see remark 999 (324-326)
      • see remark 999 (328)
      • see remark 999 (330)
      • see remark 999 (333)
      • see remark 999 (336)
      • modified residue (339)
      • see remark 999 (340-341)
      • see remark 999 (343)
      • see remark 999 (346-348)
    Domains in SCOPe 2.04: d2i0ea_
  • Chain 'B':
    Compound: Protein Kinase C-beta II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05771
      • modified residue (179)
      • see remark 999 (330)
      • see remark 999 (333)
      • see remark 999 (336)
      • modified residue (339)
      • see remark 999 (340-341)
      • see remark 999 (343)
      • see remark 999 (346-348)
    Domains in SCOPe 2.04: d2i0eb_
  • Heterogens: PDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i0eA (A:)
    ttntvskfdnngnrdrmkltdfnflmvlgkgsfgkvmlserkgtdelyavkilkkdvviq
    dddvectmvekrvlalpgkppfltqlhscfqtmdrlyfvmeyvnggdlmyhiqqvgrfke
    phavfyaaeiaiglfflqskgiiyrdlkldnvmldseghikiadfgmckeniwdgvttkt
    fcgtpdyiapeiiayqpygksvdwwafgvllyemlagqapfegededelfqsimehnvay
    pksmskeavaickglmtkhpgkrlgcgpegerdikehaffryidweklerkeiqppykpk
    acgrnaenfdrfftrhppvltppdqevirnidqsefegfsfvnseflkpevks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0eA (A:)
    ltdfnflmvlgkgsfgkvmlserkgtdelyavkilkkdvviqdddvectmvekrvlalpg
    kppfltqlhscfqtmdrlyfvmeyvnggdlmyhiqqvgrfkephavfyaaeiaiglfflq
    skgiiyrdlkldnvmldseghikiadfgmckeniwdgvttktfcgtpdyiapeiiayqpy
    gksvdwwafgvllyemlagqapfegededelfqsimehnvaypksmskeavaickglmtk
    hpgkrlgcgpegerdikehaffryidweklerkeiqppykpkacgrenfdrfftrhppvl
    tppdqevirnidqsefegfsfvnseflkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i0eB (B:)
    ttntvskfdnngnrdrmkltdfnflmvlgkgsfgkvmlserkgtdelyavkilkkdvviq
    dddvectmvekrvlalpgkppfltqlhscfqtmdrlyfvmeyvnggdlmyhiqqvgrfke
    phavfyaaeiaiglfflqskgiiyrdlkldnvmldseghikiadfgmckeniwdgvttkt
    fcgtpdyiapeiiayqpygksvdwwafgvllyemlagqapfegededelfqsimehnvay
    pksmskeavaickglmtkhpgkrlgcgpegerdikehaffryidweklerkeiqppykpk
    acgrnaenfdrfftrhppvltppdqevirnidqsefegfsfvnseflkpevks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i0eB (B:)
    ltdfnflmvlgkgsfgkvmlserkgtdelyavkilkkdvviqdddvectmvekrvlalpg
    kppfltqlhscfqtmdrlyfvmeyvnggdlmyhiqqvgrfkephavfyaaeiaiglfflq
    skgiiyrdlkldnvmldseghikiadfgmckeniwdgvttktfcgtpdyiapeiiayqpy
    gksvdwwafgvllyemlagqapfegededelfqsimehnvaypksmskeavaickglmtk
    hpgkrlgcgpegerdikehaffryidweklerkeiqppykpkaidqsefegfsfvnsefl
    kp