PDB entry 2i08

View 2i08 on RCSB PDB site
Description: Solvation effect in conformational changes of EF-hand proteins: X-ray structure of Ca2+-saturated double mutant Q41L-K75I of N-domain of calmodulin
Class: metal binding protein
Keywords: Calmodulin, EF-hand, Calcium-binding protein, conformational change, METAL BINDING PROTEIN
Deposited on 2006-08-10, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155
      • engineered (18)
      • engineered (40)
      • engineered (74)
    Domains in SCOPe 2.04: d2i08a_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i08A (A:)
    mdqlteeqiaefkeafslydkdgdgtittkelgtvmrslglnpteaelqdminevdadgn
    gtidfpefltmmarimky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i08A (A:)
    qlteeqiaefkeafslydkdgdgtittkelgtvmrslglnpteaelqdminevdadgngt
    idfpefltmmarim