PDB entry 2i02

View 2i02 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a pyridoxamine 5'-phosphate oxidase-like family protein (NPUN_R6570) FROM NOSTOC PUNCTIFORME PCC 73102 AT 1.80 A RESOLUTION
Class: oxidoreductase
Keywords: general stress protein of cog3871, pyridoxamine 5'-phosphate oxidase-like family protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, oxidoreductase
Deposited on 2006-08-09, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general stress protein of COG3871
    Species: Nostoc punctiforme [TaxId:63737]
    Gene: ZP_00108720.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YS45 (Start-147)
      • modified residue (25)
      • modified residue (40)
      • modified residue (100)
    Domains in SCOPe 2.06: d2i02a1
  • Chain 'B':
    Compound: general stress protein of COG3871
    Species: Nostoc punctiforme [TaxId:63737]
    Gene: ZP_00108720.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YS45 (Start-147)
      • modified residue (25)
      • modified residue (40)
      • modified residue (100)
    Domains in SCOPe 2.06: d2i02b_
  • Heterogens: CL, FMN, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i02A (A:)
    gmatstdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyag
    shkvteiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldep
    diallkvninqvnywdstssfkpqtisf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i02A (A:)
    tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdeatlwfftyagshkvteie
    hheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiallkvn
    inqvnywdstssfkpqtisf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i02B (B:)
    gmatstdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyag
    shkvteiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldep
    diallkvninqvnywdstssfkpqtisf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i02B (B:)
    tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
    eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
    kvninqvnywdsfkpqtisf