PDB entry 2hzr

View 2hzr on RCSB PDB site
Description: Crystal structure of human apolipoprotein D (ApoD)
Class: transport protein
Keywords: lipocalin, beta barrel, bilin-binding protein, TRANSPORT PROTEIN
Deposited on 2006-08-09, released 2007-08-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apolipoprotein D
    Species: Homo sapiens [TaxId:9606]
    Gene: APOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05090 (0-End)
      • engineered (20)
      • modified residue (46)
      • modified residue (90)
      • engineered (96)
      • engineered (113)
      • engineered (115)
      • engineered (117)
      • engineered (130-131)
      • modified residue (154)
    Domains in SCOPe 2.01: d2hzra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hzrA (A:)
fhlgkcpnppvqenfdvnkypgrwyeiekipttfengrciqanyslmengkikvlnqelr
adgtvnqiegeatpvnltepaklevkfswfmpsapyhilatdyenyalvysctsisqsfh
vdfawilarnvalppetvdslkniltsnnidvkkmtvtdqvncpklsahhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2hzrA (A:)
fhlgkcpnppvqenfdvnkypgrwyeiekiptgrciqanyslmegkikvlnqelradgtv
nqiegeatpvnltepaklevkfswfmpsapyhilatdyenyalvysctsisqsfhvdfaw
ilarnvalppetvdslkniltsnnidvkkmtvtdqvncpkl