PDB entry 2hzb

View 2hzb on RCSB PDB site
Description: X-Ray Crystal Structure of Protein BH3568 from Bacillus halodurans. Northeast Structural Genomics Consortium BhR60.
Class: structural genomics, unknown function
Keywords: BhR60, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-08-08, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0052 protein BH3568
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH3568
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K706
      • modified residue (97)
      • modified residue (111)
      • modified residue (135)
      • modified residue (218)
      • modified residue (237)
    Domains in SCOPe 2.07: d2hzba1
  • Chain 'B':
    Compound: Hypothetical UPF0052 protein BH3568
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH3568
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K706
      • modified residue (97)
      • modified residue (111)
      • modified residue (135)
      • modified residue (218)
      • modified residue (237)
    Domains in SCOPe 2.07: d2hzbb_
  • Chain 'C':
    Compound: Hypothetical UPF0052 protein BH3568
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH3568
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K706
      • modified residue (97)
      • modified residue (111)
      • modified residue (135)
      • modified residue (218)
      • modified residue (237)
    Domains in SCOPe 2.07: d2hzbc_
  • Chain 'D':
    Compound: Hypothetical UPF0052 protein BH3568
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH3568
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K706
      • modified residue (97)
      • modified residue (111)
      • modified residue (135)
      • modified residue (218)
      • modified residue (237)
    Domains in SCOPe 2.07: d2hzbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hzbA (A:)
    mkkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnv
    lvalseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrg
    kvlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadv
    ivigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdh
    cgvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlr
    hnaskvseailegkprtsssiqaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzbA (A:)
    kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
    valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
    vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
    vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
    gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
    naskvseaile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hzbB (B:)
    mkkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnv
    lvalseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrg
    kvlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadv
    ivigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdh
    cgvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlr
    hnaskvseailegkprtsssiqaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzbB (B:)
    kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
    valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
    vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
    vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
    gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
    naskvseaile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hzbC (C:)
    mkkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnv
    lvalseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrg
    kvlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadv
    ivigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdh
    cgvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlr
    hnaskvseailegkprtsssiqaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzbC (C:)
    kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
    valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
    vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
    vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
    gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
    naskvseaile
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hzbD (D:)
    mkkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnv
    lvalseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrg
    kvlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadv
    ivigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdh
    cgvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlr
    hnaskvseailegkprtsssiqaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzbD (D:)
    kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
    valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
    vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
    vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
    gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
    naskvseaile