PDB entry 2hz5

View 2hz5 on RCSB PDB site
Description: Crystal structure of human dynein light chain Dnlc2A
Class: transport protein
Keywords: Dnlc2A, TRANSPORT PROTEIN
Deposited on 2006-08-08, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hz5a_
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hz5b_
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hz5A (A:)
    mghhhhhhgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz5A (A:)
    eetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqn
    dltflrirskkneimvapyfliviqnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hz5B (B:)
    mghhhhhhgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz5B (B:)
    lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
    flrirskkneimvapdyfliviqnpt