PDB entry 2hz5

View 2hz5 on RCSB PDB site
Description: Crystal structure of human dynein light chain Dnlc2A
Class: transport protein
Keywords: Dnlc2A, TRANSPORT PROTEIN
Deposited on 2006-08-08, released 2007-08-14
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: HOMO SAPIENS
    Gene: DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hz5a1
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: HOMO SAPIENS
    Gene: DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hz5b1
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hz5A (A:)
    mghhhhhhgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz5A (A:)
    eetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqn
    dltflrirskkneimvapyfliviqnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hz5B (B:)
    mghhhhhhgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz5B (B:)
    lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
    flrirskkneimvapdyfliviqnpt