PDB entry 2hz3

View 2hz3 on RCSB PDB site
Description: The x-ray crystal structure of ferrous Synechocystis hemoglobin H117A mutant with a covalent linkage
Class: oxygen storage/transport
Keywords: Synechocystis, hemoglobin, heme, globin, ferrous, hexacoordinate, covalent heme vinyl link, oxygen storage-transport COMPLEX
Deposited on 2006-08-08, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechocystis sp. [TaxId:1148]
    Gene: glbN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73925 (0-122)
      • engineered (115)
    Domains in SCOPe 2.07: d2hz3a_
  • Heterogens: CD, SO2, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hz3A (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapaakrdv
    lnq