PDB entry 2hyr

View 2hyr on RCSB PDB site
Description: Crystal structure of a complex of griffithsin with maltose
Class: sugar binding protein
Keywords: griffithsin, lectins, domain swapping, mannose binding, HIV, SARS, SUGAR BINDING PROTEIN
Deposited on 2006-08-07, released 2007-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.154
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hyra1
  • Chain 'B':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hyrb1
  • Heterogens: SO4, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hyrA (A:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hyrB (B:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y