PDB entry 2hym

View 2hym on RCSB PDB site
Description: NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and Human Interferon alpha-2
Class: immune system
Keywords: interferon receptor complex, IMMUNE SYSTEM
Deposited on 2006-08-07, released 2006-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble IFN alpha/beta receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNABR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hyma1, d2hyma2
  • Chain 'B':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hymb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hymA (A:)
    sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
    ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
    invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
    vsvylehsdeqaviksplkctllppgqesefs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hymB (B:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske