PDB entry 2hye

View 2hye on RCSB PDB site
Description: Crystal Structure of the DDB1-Cul4A-Rbx1-SV5V Complex
Class: protein binding
Keywords: beta propeller, RING finger, zinc finger, propeller cluster, helical repeats, cullin repeats, PROTEIN BINDING
Deposited on 2006-08-05, released 2006-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.25
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA damage-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16531 (0-1139)
      • conflict (421)
      • conflict (897-898)
  • Chain 'B':
    Compound: Nonstructural protein V
    Species: Simian virus 5 [TaxId:11207]
    Gene: P/V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hyeb_
  • Chain 'C':
    Compound: Cullin-4A
    Species: Homo sapiens [TaxId:9606]
    Gene: CUL4A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hyec1, d2hyec2, d2hyec3
  • Chain 'D':
    Compound: RING-box protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hyed_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hyeB (B:)
    mdptdlsfspdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiq
    estnhqkgsvgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgk
    tlpsgsykgvklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwv
    gdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyeB (B:)
    pdeinklietglntveyftsqqvtgtsslgkntippgvtglltnapkiaivpaddktvpg
    kpipnpllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieeprenpdfk
    rgrdtggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hyeC (C:)
    madeaprkgsfsalvgrtngltkpaalaaapakpggaggskklviknfrdrprlpdnytq
    dtwrklheavravqsstsirynleelyqavenlcshkvspmlykqlrqacedhvqaqilp
    fredsldsvlflkkintcwqdhcrqmimirsiflfldrtyvlqnstlpsiwdmglelfrt
    hiisdkmvqsktidgilllierersgeavdrsllrsllgmlsdlqvykdsfelkfleetn
    clyaaegqrlmqerevpeylnhvskrleeegdrvityldhstqkpliacvekqllgehlt
    ailqkgldhlldenrvpdlaqmyqlfsrvrggqqallqhwseyiktfgtaivinpekdkd
    mvqdlldfkdkvdhvievcfqknerfvnlmkesfetfinkrpnkpaeliakhvdsklrag
    nkeatdeelertldkimilfrfihgkdvfeafykkdlakrllvgksasvdaeksmlsklk
    hecgaaftsklegmfkdmelskdimvhfkqhmqnqsdsgpidltvniltmgywptytpme
    vhltpemiklqevfkafylgkhsgrklqwqttlghavlkaefkegkkefqvslfqtlvll
    mfnegdgfsfeeikmatgiedselrrtlqslacgkarvlikspkgkevedgdkfifngef
    khklfrikinqiqmketveeqvsttervfqdrqyqidaaivrimkmrktlghnllvsely
    nqlkfpvkpgdlkkrieslidrdymerdkdnpnqyhyva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyeC (C:)
    kklviknfrdrprlpdnytqdtwrklheavravqsstsirynleelyqavenlcshkvsp
    mlykqlrqacedhvqaqilpfredsldsvlflkkintcwqdhcrqmimirsiflfldrty
    vlqnstlpsiwdmglelfrthiisdkmvqsktidgilllierersgeavdrsllrsllgm
    lsdlqvykdsfelkfleetnclyaaegqrlmqerevpeylnhvskrleeegdrvityldh
    stqkpliacvekqllgehltailqkgldhlldenrvpdlaqmyqlfsrvrggqqallqhw
    seyiktfgtaivinpekdkdmvqdlldfkdkvdhvievcfqknerfvnlmkesfetfink
    rpnkpaeliakhvdsklragnkeatdeelertldkimilfrfihgkdvfeafykkdlakr
    llvgksasvdaeksmlsklkhecgaaftsklegmfkdmelskdimvhfkqhmqnqsdsgp
    idltvniltmgywptytpmevhltpemiklqevfkafylgkhsgrklqwqttlghavlka
    efkegkkefqvslfqtlvllmfnegdgfsfeeikmatgiedselrrtlqslacgkarvli
    kspkgkevedgdkfifngefkhklfrikinqiqmketveeqvsttervfqdrqyqidaai
    vrimkmrktlghnllvselynqlkfpvkpgdlkkrieslidrdymerdkdnpnqyhyva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hyeD (D:)
    maaamdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanq
    asatseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyeD (D:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqkygh