PDB entry 2hxv

View 2hxv on RCSB PDB site
Description: Crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 A resolution
Class: biosynthetic protein
Keywords: Oxidoreductase, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, biosynthetic protein
Deposited on 2006-08-04, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1828
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2E8 (12-End)
      • leader sequence (8-11)
      • modified residue (12)
      • modified residue (17)
      • modified residue (64)
      • modified residue (194)
      • modified residue (353)
    Domains in SCOPe 2.06: d2hxva1, d2hxva2, d2hxva3
  • Heterogens: ZN, CL, NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hxvA (A:)
    mgsdkihhhhhhmyetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggp
    haermaiesarkkgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpv
    sgngvekfrnhgieviegvleeevkklceffityvtkkrpfvalkyastldgkiadhrgd
    skwitdklrfkvhemrniysavlvgagtvlkdnpqltcrlkegrnpvrvildrkgvlsgk
    vfrvfeenarvivfteseeaeypphvekalsdcsvesilrnlyerdidsvlveggskvfs
    efldhadvvfgfystkifgkgldvfsgylsdvsvppkfkvvnvefsdseflvemrpcsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxvA (A:)
    hhhhmyetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggphaermaie
    sarkkgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpvsgngvekf
    rnhgieviegvleeevkklceffityvtkkrpfvalkyastldgkiadhrgdskwitdkl
    rfkvhemrniysavlvgagtvlkdnpqltcrlkegrnpvrvildrkgvlsgkvfrvfeen
    arvivfteseeaeypphvekalsdcsvesilrnlyerdidsvlveggskvfsefldhadv
    vfgfystkifgkgldvfsgylsdvsvppkfkvvnvefsdseflvemrpc