PDB entry 2hxm

View 2hxm on RCSB PDB site
Description: Complex of UNG2 and a small Molecule synthetic Inhibitor
Class: hydrolase
Keywords: DNA REPAIR, URACIL, URACIL DNA GLYCOSYLASE, hydrolase
Deposited on 2006-08-03, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.183
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2hxma2, d2hxma3
  • Heterogens: 302, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hxmA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel