PDB entry 2hxl

View 2hxl on RCSB PDB site
Description: crystal structure of Chek1 in complex with inhibitor 1
Class: Transferase
Keywords: Chek1, Kinase, cell cycle checkpoint, Transferase
Deposited on 2006-08-03, released 2007-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.24
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hxla_
  • Heterogens: 422, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hxlA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgfskhiqsnldfs
    pvnsasrtpgsgwskehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxlA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
    envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
    githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
    haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
    ilvenpsaritipdikkdrwynkplkkgakrp