PDB entry 2hxk

View 2hxk on RCSB PDB site
Description: Crystal structure of S-nitroso thioredoxin
Class: oxidoreductase
Keywords: S-nitrosation, S-nitrosocysteine, OXIDOREDUCTASE
Deposited on 2006-08-03, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: TXN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5T937 (0-104)
    • modified residue (61)
    • modified residue (68)
  Domains in SCOPe 2.08: d2hxka_
• Chain 'B':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: TXN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5T937 (0-104)
    • modified residue (61)
    • modified residue (68)
  Domains in SCOPe 2.08: d2hxkb_
• Chain 'C':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: TXN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5T937 (0-104)
    • modified residue (61)
    • modified residue (68)
  Domains in SCOPe 2.08: d2hxkc_
• Heterogens: EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hxkA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hxkB (B:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hxkC (C:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv