PDB entry 2hxh

View 2hxh on RCSB PDB site
Description: KIF1A head-microtubule complex structure in adp-form
Class: transport protein
Keywords: microtubule-based motor
Deposited on 2006-08-03, released 2006-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-04.
Experiment type: EM
Resolution: 11 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hxha1, d2hxha2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hxhb1, d2hxhb2
  • Chain 'C':
    Compound: Kinesin-like protein KIF1A
    Species: MUS MUSCULUS
    Gene: Kif1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33173
      • engineered (217)
  • Heterogens: MG, GTP, GDP, TA1, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hxhA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxhA (A:)
    recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
    hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
    gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
    aiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqtnlvpyprahf
    platyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccllyrgdvvpkd
    vnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcmlsnttaiaea
    warldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hxhB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxhB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqd
    

  • Chain 'C':
    No sequence available.