PDB entry 2hxd

View 2hxd on RCSB PDB site
Description: Bifunctional dCTP deaminase-dUTPase mutant enzyme variant E145A from Methanocaldococcus jannaschii in complex with alpha,beta-imido dUTP and magnesium
Class: hydrolase
Keywords: beta barrel, Hydrolase
Deposited on 2006-08-03, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dCTP deaminase, dUMP-forming
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57872 (0-End)
      • engineered (144)
    Domains in SCOPe 2.07: d2hxda_
  • Heterogens: MG, DUP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hxdA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitlaivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxdA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitlaivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihld