PDB entry 2hx1

View 2hx1 on RCSB PDB site
Description: Crystal structure of possible sugar phosphatase, HAD superfamily (ZP_00311070.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 2.10 A resolution
Class: hydrolase
Keywords: ZP_00311070.1, possible sugar phosphatase, HAD superfamily, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, HYDROLASE
Deposited on 2006-08-02, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted sugar phosphatases of the HAD superfamily
    Species: Cytophaga hutchinsonii [TaxId:985]
    Gene: ZP_00311070.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311070 (1-283)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (84)
      • modified residue (118)
      • modified residue (189)
      • modified residue (208)
      • modified residue (210)
      • modified residue (215)
      • modified residue (220)
      • modified residue (229)
    Domains in SCOPe 2.07: d2hx1a1, d2hx1a2
  • Chain 'B':
    Compound: Predicted sugar phosphatases of the HAD superfamily
    Species: Cytophaga hutchinsonii [TaxId:985]
    Gene: ZP_00311070.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311070 (1-283)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (84)
      • modified residue (118)
      • modified residue (189)
      • modified residue (208)
      • modified residue (210)
      • modified residue (215)
      • modified residue (220)
      • modified residue (229)
    Domains in SCOPe 2.07: d2hx1b1, d2hx1b2
  • Chain 'C':
    Compound: Predicted sugar phosphatases of the HAD superfamily
    Species: Cytophaga hutchinsonii [TaxId:985]
    Gene: ZP_00311070.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311070 (1-283)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (84)
      • modified residue (118)
      • modified residue (189)
      • modified residue (208)
      • modified residue (210)
      • modified residue (215)
      • modified residue (220)
      • modified residue (229)
    Domains in SCOPe 2.07: d2hx1c1, d2hx1c2
  • Chain 'D':
    Compound: Predicted sugar phosphatases of the HAD superfamily
    Species: Cytophaga hutchinsonii [TaxId:985]
    Gene: ZP_00311070.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311070 (1-283)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (84)
      • modified residue (118)
      • modified residue (189)
      • modified residue (208)
      • modified residue (210)
      • modified residue (215)
      • modified residue (220)
      • modified residue (229)
    Domains in SCOPe 2.07: d2hx1d1, d2hx1d2
  • Heterogens: MG, CL, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hx1A (A:)
    gmqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrsp
    eqladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikml
    pvsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdv
    aiaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdil
    ggnkfgldtalvltgntriddaetkikstgivpthicesaviel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hx1B (B:)
    gmqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrsp
    eqladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikml
    pvsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdv
    aiaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdil
    ggnkfgldtalvltgntriddaetkikstgivpthicesaviel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hx1C (C:)
    gmqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrsp
    eqladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikml
    pvsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdv
    aiaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdil
    ggnkfgldtalvltgntriddaetkikstgivpthicesaviel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hx1D (D:)
    gmqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrsp
    eqladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikml
    pvsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdv
    aiaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdil
    ggnkfgldtalvltgntriddaetkikstgivpthicesaviel