PDB entry 2hwv

View 2hwv on RCSB PDB site
Description: Crystal structure of an essential response regulator DNA binding domain, VicRc in Enterococcus faecalis, a member of the YycF subfamily.
Class: transcription
Keywords: Essential response regulator, C-terminal domain, DNA-binding domain, TRANSCRIPTION
Deposited on 2006-08-02, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator VicR
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: vicR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836C2 (21-End)
      • cloning artifact (18-19)
      • initiating met (20)
    Domains in SCOPe 2.08: d2hwva1, d2hwva2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hwvA (A:)
    mgsshhhhhhssglvprgshmtigdltihpdaymvskrgekielthrefellyylakhig
    qvmtrehllqtvwgydyfgdvrtvdvtvrrlrekiedspshptylvtrrgvgyylrnpeq
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwvA (A:)
    shmtigdltihpdaymvskrgekielthrefellyylakhigqvmtrehllqtvwgydyf
    gdvrtvdvtvrrlrekiedspshptylvtrrgvgyylrnpe