PDB entry 2hwp

View 2hwp on RCSB PDB site
Description: Crystal structure of Src kinase domain in complex with covalent inhibitor PD168393
Class: transferase
Keywords: kinase, covalent, quinazoline, modification, transferase
Deposited on 2006-08-01, released 2007-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.05: d2hwpa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.05: d2hwpb_
  • Heterogens: DJK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hwpA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwpA (A:)
    akdaweipreslrvklgqgcgevwmgtwngttrvaiktflqaqvmkklrheklvqlyavv
    sepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraa
    nilvgenlvckvadffpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvn
    revldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyq
    pgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hwpB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwpB (B:)
    daweipreslrlevklgqgevwmgtwngttrvaiktlqvmkklrheklvqlyavvseepi
    yivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraanilv
    genlvckvafpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldq
    vergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl