PDB entry 2hwn

View 2hwn on RCSB PDB site
Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide
Class: transferase
Keywords: PKA, AKAP, Dimerization/Docking, D/D, Regulatory Subunit, TRANSFERASE
Deposited on 2006-08-01, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.208
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkar2a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hwna_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkar2a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hwnb_
  • Chain 'C':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkar2a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hwnc_
  • Chain 'D':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkar2a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hwnd_
  • Chain 'E':
    Compound: A Kinase binding peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2HWN
  • Chain 'F':
    Compound: A Kinase binding peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2HWN
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hwnA (A:)
    mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwnA (A:)
    ippgltellqgytvevlrqqppdlvdfaveyftrlrear
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hwnB (B:)
    mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hwnC (C:)
    mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwnC (C:)
    qippgltellqgytvevlrqqppdlvdfaveyftrlrear
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hwnD (D:)
    mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwnD (D:)
    shiqippgltellqgytvevlrqqppdlvdfaveyftrlrear
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.