PDB entry 2hw9

View 2hw9 on RCSB PDB site
Description: Crystal structure of Lys12Cys/Cys117Val mutant of human acidic fibroblast Growth factor at 1.60 angstrom resolution.
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-08-01, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (17)
      • engineered (122)
    Domains in SCOPe 2.07: d2hw9a1, d2hw9a2
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (17)
      • engineered (122)
    Domains in SCOPe 2.07: d2hw9b1, d2hw9b2
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hw9A (A:)
    hhhhhhfnlppgnykkpcllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hw9A (A:)
    hhhhfnlppgnykkpcllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    vkrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hw9B (B:)
    hhhhhhfnlppgnykkpcllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hw9B (B:)
    hhhhfnlppgnykkpcllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    vkrgprthygqkailflplpv