PDB entry 2hw4

View 2hw4 on RCSB PDB site
Description: Crystal structure of human phosphohistidine phosphatase
Class: structural genomics, hydrolase
Keywords: phosphohistidine, phosphatase, phpt1, human, Structural Genomics, Structural Genomics Consortium, SGC, hydrolase
Deposited on 2006-07-31, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14 kDa phosphohistidine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PHPT1, PHP14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRX4 (23-End)
      • cloning artifact (17-22)
    Domains in SCOPe 2.07: d2hw4a1, d2hw4a2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hw4A (A:)
    mhhhhhhssgvdlgtenlyfqsmdlalipdvdidsdgvfkyvlirvhsaprsgapaaesk
    eivrgykwaeyhadiydkvsgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaq
    haistekikakypdyevtwandgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hw4A (A:)
    lyfqsmdlalipdvdidsdgvfkyvlirvhsaeskeivrgykwaeyhadiydkvsgdmqk
    qgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwan