PDB entry 2hvy

View 2hvy on RCSB PDB site
Description: Crystal structure of an H/ACA box RNP from Pyrococcus furiosus
Class: isomerase/biosynthetic protein/RNA
Keywords: H/ACA RNA, RNP, PSEUDOURIDINE synthase, Guide RNA, ISOMERASE-BIOSYNTHETIC PROTEIN-RNA COMPLEX
Deposited on 2006-07-31, released 2006-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tRNA pseudouridine synthase B
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: truB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvya1, d2hvya2
  • Chain 'B':
    Compound: Small nucleolar rnp similar to gar1
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: GAR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvyb1
  • Chain 'C':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: NOP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvyc1
  • Chain 'D':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rpl7ae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvyd1
  • Chain 'E':
    Compound: h/aca RNA
    Species: synthetic, synthetic
  • Heterogens: ZN, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hvyA (A:)
    mardevrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptsh
    evvawikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdv
    pedkiiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyi
    rslihhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkai
    qpmekavehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalg
    kammtsqemlektkgiavdvekvfmprdwypklwekrdrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvyA (A:)
    rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
    kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
    vmkefegeiiqrppllrtrkvyyievleiegrdvlfrvgveagtyirslihhiglalgvg
    ahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekavehlpkvw
    ikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqemlektk
    giavdvekvfmprdwypklw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hvyB (B:)
    mekqgekmkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyv
    aikpkvsnpeiyvgevlyvderkrkespkknkekrmkkkkrlnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvyB (B:)
    mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
    npeiyvgevlyvde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hvyC (C:)
    mkfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgigrkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvyC (C:)
    frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hvyD (D:)
    maakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdp
    eeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvk
    elmkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvyD (D:)
    kpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeei
    vahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvkelm
    k
    

  • Chain 'E':
    No sequence available.